PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0008s0898.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YC
Protein Properties Length: 262aa    MW: 28868 Da    PI: 5.636
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0008s0898.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.73e-196861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + ++  +t+    ++ +v+r  ifdfl ++v +
  Kaladp0008s0898.1.p  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYGITVQTGAKTVSSLHLKHCVQRYSIFDFLKEVVNK 86
                         5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.1E-25372IPR009072Histone-fold
SuperFamilySSF471132.37E-19489IPR009072Histone-fold
PfamPF008088.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YGITVQTGAK  60
TVSSLHLKHC VQRYSIFDFL KEVVNKVPDY NHSSTSGEVR AISRRRKATG DELSDSDEHS  120
KRSRLQETSH GTVGGKGRGR GRGRGRGRAG HMAGPDSVQH DFEPEPSMAN LDANDNKSRD  180
LASDSKEDDD GLTNLAVGKF DLNTEFKENN SMPALAIPDN LSAHPDNLQL SLSEMDRIEF  240
NTLQLGSMNS TFDDEDYDED G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A9e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137147RGRGRGRGRGR
2139148RGRGRGRGRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432367.12e-77hypothetical protein CICLE_v10002081mg
TrEMBLV4SXS02e-77V4SXS0_9R
STRINGVIT_13s0084g00040.t018e-68(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.19e-67nuclear factor Y, subunit C11